UniProt AC | UniProt Status | Protein Name | Organism | PMID | Article Title | Category | Annotation | Contributor | ORCID | Submission Date | |
Q96JM7 | Reviewed | Lethal(3)malignant brain tumor-like protein 3 | Homo sapiens (Human). | 33326746 | High-Throughput Discovery and Characterization of Human Transcriptional Effectors | [Function][Pathology & Biotech] | Protein/gene_name: L3MBTL3. Function: The subsequence GIPASKVSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNSHN, which contains the SAM_1 domain; and the subsequence TVAGIPASKVSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKN show transcriptional repressor activity in a high-throughput recruitment assay. Additional Annotation: Large scale analysis. Pfam domain ID=SAM_1. | Josh Tycko | 0000-0002-4108-0575 | 2021-5-20 |