Anonymous Guests can only review public / in process entries sent to UUW

Once logged in with ORCID account, entries you submitted will be visible.

Contact informatin and emails are only shown to curators.






  • 1
  • 2
  • 3
  • 4
  • 5
  • 6
  • ...
  • 15
UniProt AC
UniProt Status
Protein Name
Organism
PMID
Article Title
Category
Annotation
Contributor
ORCID logoORCID
Submission Date
P50548ReviewedETS domain-co Homo sapiens (Human).9136988ERF: genomic organization, chromosomal localization and promoter analysis of the human and mouse genes.[Sequence]Protein/gene_name: ETS domain-containing transcription factor; ERF.
Additional Annotation: Utilizing FISH, somatic cell hybrids and linkage analysis, the chromosomal position of ERF on human chromosome 19q13.1 and on its syntenic region in the mouse, on chromosome 7 were determined. Sequence analysis of the mouse gene indicated a 90% identity to the human gene within the coding and promoter regions. The predicted Erf protein is 98% identical to the human protein and all of the identifiable motifs are conserved between the two proteins. A number of conserved transcription factor binding sites are identified in the region including an ets binding site (EBS). Removal of a small segment that includes the EBS seriously hampers promoter function, suggesting the ERF transcription may be regulated by ets-domain proteins.
Nicholas Moschonas0000-0002-2556-537X2022-5-15
P50548ReviewedETS domain-co Homo sapiens (Human).33326746High-Throughput Discovery and Characterization of Human Transcriptional Effectors[Function][Pathology & Biotech]Protein/gene_name: ERF.
Function: The subsequence SEGESEEVEVTDISDEDEEDGEVFKTPRAPPAPPKPEPGEAPGASQCMPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGED shows transcriptional repressor activity in a high-throughput recruitment assay.
Additional Annotation: Large scale analysis.
Josh Tycko0000-0002-4108-05752021-5-20