UniProt AC | UniProt Status | Protein Name | Organism | PMID | Article Title | Category | Annotation | Contributor | ORCID | Submission Date | |
P50548 | Reviewed | ETS domain-co | Homo sapiens (Human). | 9136988 | ERF: genomic organization, chromosomal localization and promoter analysis of the human and mouse genes. | [Sequence] | Protein/gene_name: ETS domain-containing transcription factor; ERF. Additional Annotation: Utilizing FISH, somatic cell hybrids and linkage analysis, the chromosomal position of ERF on human chromosome 19q13.1 and on its syntenic region in the mouse, on chromosome 7 were determined. Sequence analysis of the mouse gene indicated a 90% identity to the human gene within the coding and promoter regions. The predicted Erf protein is 98% identical to the human protein and all of the identifiable motifs are conserved between the two proteins. A number of conserved transcription factor binding sites are identified in the region including an ets binding site (EBS). Removal of a small segment that includes the EBS seriously hampers promoter function, suggesting the ERF transcription may be regulated by ets-domain proteins. | Nicholas Moschonas | 0000-0002-2556-537X | 2022-5-15 | |
P50548 | Reviewed | ETS domain-co | Homo sapiens (Human). | 33326746 | High-Throughput Discovery and Characterization of Human Transcriptional Effectors | [Function][Pathology & Biotech] | Protein/gene_name: ERF. Function: The subsequence SEGESEEVEVTDISDEDEEDGEVFKTPRAPPAPPKPEPGEAPGASQCMPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGED shows transcriptional repressor activity in a high-throughput recruitment assay. Additional Annotation: Large scale analysis. | Josh Tycko | 0000-0002-4108-0575 | 2021-5-20 |