UniProt AC | UniProt Status | Protein Name | Organism | PMID | Article Title | Category | Annotation | Contributor | ORCID | Submission Date | |
Q9NZR4 | Reviewed | Visual system homeobox 1 | Homo sapiens (Human). | 33326746 | High-Throughput Discovery and Characterization of Human Transcriptional Effectors | [Function][Pathology & Biotech] | Protein/gene_name: VSX1. Function: The subsequence KASPTLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMA, which contains the Homeodomain domain, shows transcriptional repressor activity in a high-throughput recruitment assay. Additional Annotation: Large scale analysis. Pfam domain ID=Homeodomain. | Josh Tycko | 0000-0002-4108-0575 | 2021-5-20 |